PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT10411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 751aa    MW: 81490.8 Da    PI: 7.1214
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT10411genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.5e-28270323155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  EMT10411 270 KPRVVWSVELHQQFVNAVNHL-GIDKAVPKKILELMNVPGLTRENVASHLQKFRL 323
               79*******************.********************************8 PP

2Response_reg59.12.4e-2010219418109
                   HHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  18 lekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                   l +  + +++++++++ al++l+e++  +D+i+ D+ mp+m+G++ll+     e++lp+i+++a +  +++ + +k Ga d+l Kp+ +eel +
      EMT10411 102 LARVAIGQATTCSQATRALAMLRENRgaFDVIISDVHMPDMNGFRLLELVGL-EMDLPVIMMSADSRTDLVMKGIKHGACDYLIKPVRMEELKN 194
                   4477777899*************99999*******************87754.558***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.9E-41643No hitNo description
SMARTSM004484.0E-1682196IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011031.70183200IPR001789Signal transduction response regulator, receiver domain
PIRSFPIRSF0363921.7E-158101736IPR017053Response regulator B-type, plant
PfamPF000726.5E-17102194IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.65E-20109199No hitNo description
Gene3DG3DSA:3.40.50.23003.8E-30109226No hitNo description
SuperFamilySSF521725.55E-25110204IPR011006CheY-like superfamily
PROSITE profilePS5129411.948267326IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-29267328IPR009057Homeodomain-like
SuperFamilySSF466891.54E-19268327IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25270323IPR006447Myb domain, plants
PfamPF002498.7E-7272321IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010029Biological Processregulation of seed germination
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MAPPEEAGGG DQFPVGMKVL VVDDDQTCLA VLKRMLVQCR YDVWFYLGTL NDFNAYPFQS  60
WHHFKSRFSI LGGLTRGTTI CLLVLQSDKH PWRLDTWHHH LLARVAIGQA TTCSQATRAL  120
AMLRENRGAF DVIISDVHMP DMNGFRLLEL VGLEMDLPVI MMSADSRTDL VMKGIKHGAC  180
DYLIKPVRME ELKNIWQHVV RKKFGGNKEH EHSGSLDDTD RNRLTNNDNE YASSANDGAE  240
DSWKSQKKKR DKEEDDSELE SGDPSNNSKK PRVVWSVELH QQFVNAVNHL GIDKAVPKKI  300
LELMNVPGLT RENVASHLQK FRLYLKRIAQ HHAGMANPYG VPASSAQVAS LGGLDFQALA  360
ASGQIPPQAL AALQDELLGR PTNSLVLPGR DQSSLRLAAV KGNKPHGEQI AFGQPIYKVQ  420
NNSYAALPQN NPAAGRMPSF SAWPNNKLGM SDSMSALGNV NNSQNSNMVL HELQQQPDTM  480
LSGTLHTLDV KPSGIVMPSQ SLNTFPASEG LSANQNSLII PSQSSGFLTG IPPSMKPELV  540
LPTSQSSNSL LGGIDLINQA STSQPFISSH GGNLPGLMNR NSNVMPSQGI SSFQTGNTPY  600
LVNQNSMGMG SKPPGVLKTE STDSLNQNYA YANHMDSGLL SSQSKNAQFG FLQSPNDVTG  660
GWSSLQNMDG YRNTVGPSQP VSSSSSFQSS NAALGKLPDQ GRGKNLGFVG KGACIPNRFA  720
VDEIESPTNS LSHSIGSSGD IQDMFGFSGQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23269329464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519270.0JF951927.1 Triticum aestivum clone TaMYB44 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558456.10.0PREDICTED: two-component response regulator ORR21
SwissprotQ8H7S70.0ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLM8B8T70.0M8B8T7_AEGTA; Two-component response regulator ARR2
STRINGBRADI1G69480.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57963754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-90response regulator 2